PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000275800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 429aa    MW: 47398.3 Da    PI: 9.8212
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000275800genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.66.9e-19124169147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+W++eEde l ++vk +G+++W++I++ ++ gR++k+c++rw + 
    MDP0000275800 124 KGPWSPEEDEALQNLVKIYGPRNWSLISKSIP-GRSGKSCRLRWCNQ 169
                      79******************************.***********985 PP

2Myb_DNA-binding55.41.4e-17178220347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEd+ l++a++++G++ W+tIar ++ gRt++ +k++w++ 
    MDP0000275800 178 PFSPEEDDTLIRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 220
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.149119174IPR017930Myb domain
SuperFamilySSF466894.87E-32121217IPR009057Homeodomain-like
SMARTSM007172.6E-17123172IPR001005SANT/Myb domain
PfamPF002495.5E-18124169IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-24125175IPR009057Homeodomain-like
CDDcd001676.73E-16126168No hitNo description
SMARTSM007172.1E-15175223IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-23176224IPR009057Homeodomain-like
PROSITE profilePS5129421.119176225IPR017930Myb domain
CDDcd001675.21E-12178221No hitNo description
PfamPF002492.2E-15178220IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MKQPGRDQTT NHSIESIPPV RRWGRLWQFS FRWGERDRHV AVGEVRGKRK RRVVVDSCML  60
ITALPGKIHT RNGSDRLLGP AIPSYLYLFP RIYLYPPAPV SPSSSQNKDL FSMASTKKVV  120
DRIKGPWSPE EDEALQNLVK IYGPRNWSLI SKSIPGRSGK SCRLRWCNQL SPEVEHRPFS  180
PEEDDTLIRA HARFGNKWAT IARLLNGRTD NAIKNHWNST LKRKCSSMSE DLCSDVHDHP  240
PHKRSASVGA VSGTGLYFNP GSPSGSDLSD SSLHGGVSPS SQVFTPXARP VPPPIAPPPM  300
EAATSAVAVD PPTSLSLSLP GSESESCDGS NHMGSGFGSN PIVGPTQMVE QPHEVAAPPP  360
VVGLLPPPRQ SNLNNNQQFF SSEFLDVMQE MIRKEVRNYM TGIEQKGQCM QTEAIRNAVI  420
KRIXISKIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C8e-381232243104C-Myb DNA-Binding Domain
1msf_C8e-381232243104C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.126450.0bud| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6273120.0AB627312.1 Malus x domestica mRNA, microsatellite: MEST188, clone: SAM01_20_H07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008351984.10.0PREDICTED: transcription factor MYB44-like
RefseqXP_008367655.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW15e-85MYB44_ARATH; Transcription factor MYB44
TrEMBLD9ZJ620.0D9ZJ62_MALDO; MYB domain class transcription factor
STRINGPOPTR_0002s12410.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.15e-69myb domain protein 73